Analytical Data
-
Gene name
ATP7b
- Application
-
Alternative Names
ATP7b；PWD；WC1；WND；Copper-transporting ATPase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35670
-
Expression Region
1372-1465aa
-
AA Sequence
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQ VSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEEQYI
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATP7B is a crucial protein that plays a significant role in copper homeostasis and is primarily associated with Wilson's disease, a genetic disorder characterized by excessive copper accumulation in the body. This disorder arises from mutations in the ATP7B gene, leading to impaired copper transport and toxicity. Research on ATP7B recombinant protein is essential for understanding the molecular mechanisms of Wilson's disease and developing potential therapeutic strategies. By expressing and purifying the ATP7B recombinant protein, scientists can study its structure, function, and interaction with copper. This knowledge is vital for identifying the specific mutations that disrupt its activity and for exploring potential treatments, such as gene therapy or pharmacological agents aimed at restoring normal copper metabolism. Additionally, the study of ATP7B recombinant protein may provide insights into similar copper transport mechanisms in other organisms, contributing to a broader understanding of metal ion homeostasis in biological systems. As research progresses, ATP7B may also become a target for innovative interventions in not only Wilson's disease but also other disorders linked to copper dysregulation.
