Analytical Data
-
Gene name
LASS4
- Application
-
Alternative Names
CERS4; LASS4; Ceramide synthase 4; CerS4; LAG1 longevity assurance homolog 4; Sphingosine N-acyltransferase CERS4
-
Species
Human
-
Source
E. coli
-
Tag
His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9HA82
-
Expression Region
1-394aa
-
AA Sequence
MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLLAMRLAFERFIGLPLSRWLGVRDQTRRQVKPNATLEKHFLTEGHRPKEPQLSLLAAQCGLTLQQTQRWFRRRRNQDRPQLTKKFCEASWRFLFYLSSFVGGLSVLYHESWLWAPVMCWDRYPNQTLKPSLYWWYLLELGFYLSLLIRLPFDVKRKDFKEQVIHHFVAVILMTFSYSANLLRIGSLVLLLHDSSDYLLEACKMVNYMQYQQVCDALFLIFSFVFFYTRLVLFPTQILYTTYYESISNRGPFFGYYFFNGLLMLLQLLHVFWSCLILRMLYSFMKKGQMEKDIRSDVEESDSSEEVAAAQEPLQLKNGAAGGPRPAPTDGPQSRVAGRLTNRHTTAT
-
Molecular Weight
46 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Identification
Protein Description
LASS4, or Longevity Assurance Gene 4, is a member of the LASS gene family, which is known for its role in sphingolipid metabolism. Research on LASS4 has gained significant attention due to its potential implications in cellular longevity and various diseases, including cancer and neurodegenerative disorders. The protein is involved in the synthesis of ceramides, which are crucial for maintaining cellular integrity and signaling. Abnormalities in sphingolipid metabolism have been linked to numerous pathological conditions, making LASS4 a promising target for therapeutic interventions. Studies indicate that LASS4 may play a protective role in stress responses and apoptosis, suggesting its importance in cellular homeostasis. Furthermore, the exploration of LASS4 as a biomarker for disease progression is ongoing, with researchers aiming to understand the molecular mechanisms that underlie its function. The manipulation of LASS4 expression and activity may provide novel approaches to enhance cell survival and mitigate disease, emphasizing the necessity of further studies to unravel the complexities of this intriguing protein.
