Analytical Data
-
Gene name
MPI
- Application
-
Alternative Names
MPI;PMI1;Mannose-6-phosphate isomerase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P34949
-
Expression Region
1-423aa
-
AA Sequence
AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL
-
Molecular Weight
73.5kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant proteins, particularly those expressed through the use of the Multipurpose Protein Interface (MPI) technology, has gained significant attention in the field of molecular biology and biotechnology. Recombinant proteins are artificially produced through the insertion of specific genes into host cells, enabling the large-scale production of proteins for various applications, including therapeutic agents, vaccines, and industrial enzymes. As the demand for high-quality proteins increases, MPI technology has emerged as a versatile platform that facilitates the efficient expression, purification, and characterization of recombinant proteins. Its unique ability to optimize protein folding and solubility has led to breakthroughs in the production of difficult-to-express proteins, many of which play crucial roles in disease mechanisms or biotechnological processes. Moreover, the application of MPI extends to the development of protein-based diagnostics, targeted therapies, and even novel biomaterials. This work is particularly relevant in the context of emerging infectious diseases and the need for rapid vaccine development, as exemplified during recent global health crises. As research progresses, MPI technology is continually refined, paving the way for innovative strategies that enhance protein yield and functionality, thus driving forward the field of protein engineering and its applications in medicine and industry.
