Analytical Data
-
Gene name
PLCz1
- Application
-
Alternative Names
PLCz1；1-phosphatidylinositol 4.5-bisphosphate phosphodiesterase zeta-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q86YW0
-
Expression Region
322-572aa
-
AA Sequence
KETGVKKLPGVMLFKKKKTRKLKIALALSDLVIYTKAEKFKSFQHSRLYQQFNENNSIGETQARKLSKLRVHEFIFHTRKFITRIYPKATRADSSNFNPQEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESKSYFNPSNIKEGMPITLTIRLISGIQLPLTHSSSNKGDSLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETFTFIIHVPELALIRFVVEGQGLIAGNEFLGQYT
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PLCz1, or phospholipase C zeta 1, is a pivotal enzyme that plays a crucial role in the regulation of intracellular calcium signaling, particularly during the process of oocyte fertilization and early embryonic development. Initially identified in mammalian sperm, PLCz1 is responsible for generating inositol trisphosphate (IP3) and diacylglycerol (DAG) from phosphatidylinositol 4,5-bisphosphate (PIP2), leading to the release of calcium ions from the endoplasmic reticulum. This calcium signal is essential for initiating various cellular processes, including egg activation, cell cycle progression, and embryo development. Abnormalities in PLCz1 function have been linked to infertility and developmental disorders, highlighting its significance in reproductive biology and developmental genetics. The study of recombinant PLCz1 proteins allows researchers to dissect the molecular mechanisms underlying its enzymatic activity, interactions with other proteins, and its role in calcium signaling pathways. Understanding PLCz1 further is crucial for developing potential therapeutic strategies for infertility treatments and elucidating the fundamental processes of cellular signaling and development. The ongoing research aims to provide insight into its structure-function relationship, regulatory mechanisms, and impacts of mutations, thereby contributing to a deeper comprehension of its biological significance.
