Analytical Data
-
Gene name
CHRNa3
- Application
-
Alternative Names
CHRNa3；NACHRA3；Neuronal acetylcholine receptor subunit alpha-3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P32297
-
Expression Region
32-240aa
-
AA Sequence
SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
-
Molecular Weight
44.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Research on the CHRNa3 recombinant protein has gained significant attention due to its crucial role in the molecular mechanisms underlying various biological processes. CHRNa3, which refers to the alpha 3 subunit of the nicotinic acetylcholine receptor (nAChR), is part of a family of ligand-gated ion channels that mediate synaptic transmission in the nervous system. These receptors are pivotal in neurophysiology, influencing neurotransmitter release and modulating neural excitability. Aberrations in nAChR function, particularly involving the CHRNa3 subunit, have been implicated in several neurological disorders, including Alzheimer's disease, schizophrenia, and nicotine addiction. The expression and purification of the CHRNa3 recombinant protein allow for detailed structural and functional studies, thereby elucidating its role in receptor pharmacology and ligand binding. Moreover, this research is instrumental in the development of therapeutic agents targeting nAChRs, with potential applications in treating cognitive deficits and substance abuse disorders. Advances in understanding CHRNa3 interactions at the molecular level could pave the way for innovative strategies in drug design and neurobiological interventions, highlighting the importance of this research in both basic science and clinical contexts.
