Cat: PA2000-487DB

Recombinant Human ALDH9A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ALDH9A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ALDH9A1;ALDH4;ALDH7;ALDH9;4-trimethylaminobutyraldehyde dehydrogenase

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P49189

  • Expression Region

    1-494aa

  • AA Sequence

    MSTGTFVVSQPLNYRGGARVEPADASGTEKAFEPATGRVIATFTCSGEKE VNLAVQNAKAAFKIWSQKSGMERCRILLEAARIIREREDEIATMECINNG KSIFEARLDIDISWQCLEYYAGLAASMAGEHIQLPGGSFGYTRREPLGVC VGIGAWNYPFQIASWKSAPALACGNAMVFKPSPFTPVSALLLAEIYSEAG VPPGLFNVVQGGAATGQFLCQHPDVAKVSFTGSVPTGMKIMEMSAKGIKP VTLELGGKSPLIIFSDCDMNNAVKGALMANFLTQGQVCCNGTRVFVQKEI LDKFTEEVVKQTQRIKIGDPLLEDTRMGPLINRPHLERVLGFVKVAKEQG AKVLCGGDIYVPEDPKLKDGYYMRPCVLTNCRDDMTCVKEEIFGPVMSIL SFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVVAELQAGTCFINNYNV SPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDVESAF

  • Molecular Weight

    53.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ALDH9A1, a member of the aldehyde dehydrogenase (ALDH) superfamily, plays a critical role in the metabolism of neurotransmitters and detoxification processes. Its primary function involves the oxidation of aldehydes to their corresponding carboxylic acids, which is essential in mitigating oxidative stress and maintaining cellular homeostasis. Recent studies have highlighted the significance of ALDH9A1 in various physiological and pathological contexts, including its involvement in neurological disorders and metabolic diseases. Mutations or dysregulation of ALDH9A1 have been linked to conditions such as hyperprolinemia, which is characterized by elevated levels of proline and can lead to neurodevelopmental issues. Research into recombinant ALDH9A1 proteins has gained momentum as scientists seek to elucidate the enzyme’s structural biology and catalytic mechanisms. Recombinant production allows for a detailed analysis of the enzyme's active site and substrate interactions, paving the way for potential therapeutic interventions. Moreover, exploring the regulation of ALDH9A1 expression and activity provides insights into its biochemical pathways, further enhancing our understanding of its role in health and disease. The study of recombinant ALDH9A1 can also facilitate the development of pharmacological agents aimed at modulating its activity, thus offering promising avenues for the treatment of related disorders. In summary, the investigation of ALDH9A1 recombinant proteins is of paramount importance for understanding its biological functions and therapeutic potential, making it a focal point in current biochemical and medical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US