Cat: PA1000-1972

Recombinant Human NDUFAF2 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDUFAF2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDUFAF2;NDUFA12L;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8N183

  • Expression Region

    1-169aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGN KYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRK TPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIK GHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ

  • Molecular Weight

    22 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDUFAF2, a mitochondrial protein, plays a crucial role in the assembly of the mitochondrial respiratory chain complex I, which is vital for cellular energy production through oxidative phosphorylation. Mutations in the NDUFAF2 gene have been linked to various mitochondrial disorders, highlighting its importance in maintaining mitochondrial function and overall cellular health. Research on NDUFAF2 recombinant protein focuses on understanding its structure, function, and interaction with other mitochondrial proteins. By studying this protein, scientists aim to elucidate the mechanisms of mitochondrial dysfunction associated with genetic diseases and to identify potential therapeutic targets. Furthermore, the recombinant expression of NDUFAF2 allows for detailed analyses of its physiological roles, contributing to the broader understanding of mitochondrial biogenesis and the pathogenesis of related disorders. As mitochondrial defects are implicated in various conditions, including neurodegenerative diseases and metabolic syndromes, NDUFAF2 serves as a significant focus for developing novel therapeutic strategies aimed at restoring mitochondrial function and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US