Analytical Data
-
Gene name
NDUFAF2
- Application
-
Alternative Names
NDUFAF2;NDUFA12L;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N183
-
Expression Region
1-169aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGWSQDLFRALWRSLSREVKEHVGTDQFGN KYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRK TPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIK GHASAPYFGKEEPSVAPSSTGKTFQPGSWMPRDGKSHNQ
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFAF2, a mitochondrial protein, plays a crucial role in the assembly of the mitochondrial respiratory chain complex I, which is vital for cellular energy production through oxidative phosphorylation. Mutations in the NDUFAF2 gene have been linked to various mitochondrial disorders, highlighting its importance in maintaining mitochondrial function and overall cellular health. Research on NDUFAF2 recombinant protein focuses on understanding its structure, function, and interaction with other mitochondrial proteins. By studying this protein, scientists aim to elucidate the mechanisms of mitochondrial dysfunction associated with genetic diseases and to identify potential therapeutic targets. Furthermore, the recombinant expression of NDUFAF2 allows for detailed analyses of its physiological roles, contributing to the broader understanding of mitochondrial biogenesis and the pathogenesis of related disorders. As mitochondrial defects are implicated in various conditions, including neurodegenerative diseases and metabolic syndromes, NDUFAF2 serves as a significant focus for developing novel therapeutic strategies aimed at restoring mitochondrial function and improving patient outcomes.











