Analytical Data
-
Gene name
MIF
- Application
-
Alternative Names
MIF;GLIF;MMIF;Macrophage migration inhibitory factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P14174
-
Expression Region
2-115aa
-
AA Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
-
Molecular Weight
41.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of macrophage migration inhibitory factor (MIF) recombinant proteins has gained significant attention in recent years due to the critical role MIF plays in various physiological and pathological processes. Initially identified as a mediator of immune responses, MIF is produced by a variety of cell types, including macrophages, and is involved in the regulation of inflammatory responses, cell proliferation, and apoptosis. Its dysregulation has been implicated in numerous diseases, including autoimmune disorders, cancer, and metabolic diseases. The recombinant production of MIF allows for a detailed investigation of its biological functions, as well as the exploration of its potential as a therapeutic target. By utilizing recombinant DNA technology, researchers can produce MIF in a controlled environment, providing sufficient quantities for functional studies and the development of MIF inhibitors or monoclonal antibodies. Furthermore, the use of MIF recombinant proteins in preclinical models has opened avenues for understanding its mechanisms in disease pathogenesis and the identification of novel treatment strategies. As research continues to elucidate the multifaceted roles of MIF, recombinant proteins offer valuable tools for both basic and applied biomedical research, potentially leading to innovative therapeutic interventions in conditions characterized by MIF dysregulation.
