Cat: PA2000-8803

Recombinant Human KRTAP17-1 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRTAP17-1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KRTAP17-1; KAP17.1; KRTAP16.1Keratin-associated protein 17-1; Keratin-associated protein 16.1

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BYP8

  • Expression Region

    1-105aa

  • AA Sequence

    MGCCPGDCFTCCTQEQNCCEECCCQPGCCGCCGSCCGCGGSGCGGSGCGGSCCGSSCCGSGCGGCGGCGGCGGGCCGSSCCGSSCCGSGCCGPVCCQPTPICDTK

  • Molecular Weight

    38.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRTAP17-1, a member of the keratin-associated protein (KRTAP) family, plays a crucial role in hair and skin biology, particularly in the formation of the hair follicle and the structure of the cuticle. Keratin-associated proteins are integral to the architecture of keratin fibers, influencing properties such as strength, elasticity, and resilience of hair and skin. The study of KRTAP17-1 has gained prominence due to its potential implications in dermatological conditions and hair disorders. Research indicates that variations in KRTAP genes may be linked to diverse phenotypes, including hair texture and density, thereby shedding light on genetic contributions to these traits. Additionally, KRTAP17-1 is being explored for its potential utility in cosmetic applications, where enhancing keratin-associated protein expression could lead to improved hair health and appearance. The recombinant production of KRTAP17-1 has become a focal point for experimental studies, as it allows for detailed analysis of its structural and functional characteristics. By understanding the properties and interactions of KRTAP17-1, researchers aim to develop targeted therapies and innovative cosmetic solutions that harness the natural properties of keratins and their associated proteins, paving the way for advancements in both medical and aesthetic dermatology. Overall, the investigation of KRTAP17-1 and its recombinant forms stands at the intersection of molecular biology, genetics, and cosmetic science, highlighting its significance in contemporary research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US