Analytical Data
-
Gene name
KRTAP11-1
- Application
-
Alternative Names
KRTAP11-1; KAP11.1; KRTAP11.1Keratin-associated protein 11-1; High sulfur keratin-associated protein 11.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUC1
-
Expression Region
1-163aa
-
AA Sequence
MSFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSWLLDHCQETCCEPTACQPTCYRRTSCVSNPCQVTCSRQTTCISNPCSTTYSRPLTFVSSGCQPLGGISSVCQPVGGISTVCQPVGGVSTVCQPACGVSRTYQQSCVSSCRRTC
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP11-1, a member of the keratin-associated protein (KAP) family, is primarily expressed in skin and hair follicles, playing a crucial role in the structural integrity and functional properties of hair and the epidermis. Research into KRTAP11-1 has gained attention due to its potential involvement in various dermatological conditions, such as alopecia and other hair disorders, where alterations in keratin composition can lead to structural abnormalities. The protein is believed to contribute to the mechanical resilience and chemical stability of keratin fibers, influencing traits like hair texture and strength. Furthermore, understanding the molecular mechanisms of KRTAP11-1's function can provide insights into hair growth cycles and the development of therapeutic strategies for hair loss and skin diseases. Advances in recombinant protein technology enable the production of KRTAP11-1 for functional studies, facilitating the exploration of its interactions with keratin and other cellular components. This research not only highlights the significance of KRTAP11-1 in dermatology but also opens avenues for novel treatments that target the molecular basis of hair and skin disorders.
