Analytical Data
-
Gene name
KRTAP10-6
- Application
-
Alternative Names
KRTAP10-6; KAP10.6; KAP18-6; KRTAP10.6; KRTAP18-6; KRTAP18.6Keratin-associated protein 10-6; High sulfur keratin-associated protein 10.6; Keratin-associated protein 10.6; Keratin-associated protein 18-6; Keratin-associated protein 18.6
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P60371
-
Expression Region
1-365aa
-
AA Sequence
MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSGQKSSC
-
Molecular Weight
40.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP10-6, a member of the keratin-associated protein (KAP) family, plays a significant role in the structural integrity and functional properties of mammalian hair and wool fibers. The study of KRTAP10-6 is particularly relevant due to its involvement in various biological processes, including keratinocyte differentiation and hair follicle development. Research has indicated that KRTAP10-6 exhibits a distinct expression pattern, being predominantly found in hair follicles, suggesting its essential role in the formation of the hair matrix and the overall architecture of hair. Disturbances in KRTAP expression have been linked to hair disorders, making it a potential biomarker for conditions like alopecia and other hair pathologies. Advances in recombinant protein technology have enabled the production and characterization of KRTAP10-6, facilitating in-depth studies on its biochemical properties and interactions with other keratin proteins. By elucidating the molecular mechanisms underlying KRTAP10-6 function, researchers aim to uncover new avenues for therapeutic interventions in hair-related diseases and enhance our understanding of keratin biology. This makes KRTAP10-6 a focal point in both basic biological research and clinical applications, highlighting the need for comprehensive studies that address its functional properties, regulatory mechanisms, and potential roles in hair health and disease.
