Analytical Data
-
Gene name
MDH1
- Application
-
Alternative Names
MDH1;MDHA;Malate dehydrogenase. cytoplasmic
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P40925
-
Expression Region
1-334aa
-
AA Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVL DGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKD LLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKE NFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKV KLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAI CDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFV EGLPINDFSREKMDLTAKELTEEKESAFEFLSSALEHHHHHH
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MDH1 (Malate Dehydrogenase 1) is an important enzyme involved in the tricarboxylic acid (TCA) cycle, playing a crucial role in cellular metabolism by catalyzing the conversion of malate to oxaloacetate while reducing NAD+ to NADH. Given its essential function in energy production and metabolic regulation, MDH1 has attracted considerable research interest in various fields, including cancer biology, metabolic disorders, and cellular signaling. Abnormal expression or function of MDH1 has been linked to several pathologies, highlighting its potential as a therapeutic target. Recent advances in molecular biology techniques, such as recombinant protein expression and purification, have enabled the production of MDH1 in heterologous systems, facilitating detailed studies of its structure and function. By analyzing the biochemical properties and interactions of MDH1, researchers aim to uncover its role in metabolic pathways and pathophysiological conditions. Furthermore, investigating MDH1’s potential as a biomarker for disease progression and as a target for drug development is critically important in ongoing biomedical research. Consequently, the recombinant expression of MDH1 not only enhances our understanding of its physiological roles but also paves the way for innovative therapeutic strategies.
