Cat: PA1000-1894

Recombinant Human MAPK11 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAPK11

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZNHIT1;CGBP1;ZNFN4A1;Zinc finger HIT domain-containing Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q15759

  • Expression Region

    1-364aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTVWEVPQRLQGL RPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKH LKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHV QFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSD YIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA NPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESV EAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ

  • Molecular Weight

    44 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAPK11, also known as p38α MAPK, is a serine/threonine kinase that plays a critical role in various cellular processes, including inflammation, differentiation, and stress responses. This protein is a member of the mitogen-activated protein kinase (MAPK) family, which transduces extracellular signals to elicit appropriate cellular responses. Research has shown that MAPK11 is activated by diverse stimuli such as cytokines, growth factors, and environmental stressors. Its dysregulation is implicated in various diseases, including cancer, cardiovascular disorders, and neurodegenerative conditions. Consequently, MAPK11 has emerged as a potential therapeutic target, motivating the development of MAPK11 recombinant proteins for functional studies, structural analysis, and high-throughput screening of inhibitors. By generating recombinant MAPK11, researchers can explore its enzymatic activity, identify novel substrates, and elucidate its specific roles in signaling pathways. Furthermore, recombinant MAPK11 can aid in understanding the molecular mechanisms underlying MAPK signaling and its implications in pathophysiology. This research not only provides insights into fundamental cellular processes but also paves the way for the design of MAPK11-targeted therapies, thus holding promise for improving clinical outcomes in diseases linked to aberrant MAPK signaling.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US