Analytical Data
-
Gene name
KPNa1
- Application
-
Alternative Names
KPNa1；RCH2；Importin subunit alpha-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52294
-
Expression Region
8-538aa
-
AA Sequence
NFRLKSYKNKSLNPDEMRRRREEEGLQLRKQKREEQLFKRRNVATAEEETEEEVMSDGGFHEAQISNMEMAPGGVITSDMIEMIFSKSPEQQLSATQKFRKLLSKEPNPPIDEVISTPGVVARFVEFLKRKENCTLQFESAWVLTNIASGNSLQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQLFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALSYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKEAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAKRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDSSIAPQVDLNQQQYIFQQCEAPMEGFQL
-
Molecular Weight
63.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KPNa1 (Karyopherin alpha 1) is a critical nuclear transport receptor that mediates the import of various proteins into the nucleus, playing a vital role in cellular processes such as gene expression and signal transduction. As a member of the karyopherin family, KPNa1 specifically recognizes nuclear localization signals (NLS) on cargo proteins, facilitating their transport through the nuclear pore complex. Recent research has highlighted its involvement not only in classical nuclear transport but also in the regulation of key cellular functions, including cell cycle progression and apoptosis. Dysregulation of KPNa1 has been implicated in various diseases, including cancer, where it may contribute to the nuclear accumulation of oncogenic factors. Consequently, understanding KPNa1 and its mechanisms has become essential for developing novel therapeutic strategies. The study of KPNa1 recombinant protein aims to elucidate its structural and functional properties, enabling the identification of potential inhibitors that could disrupt its interaction with cargo proteins. This research holds promise for advancing our knowledge of nuclear transport mechanisms and developing targeted therapies for diseases associated with KPNa1 dysregulation.
