Cat: PA1000-1893

Recombinant Human MAPK1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAPK1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    GAREM1;C18orf11;FAM59A;GAREM;GRB2-associated and regulator of MAPK Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-terminal His Tag

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P28482

  • Expression Region

    2-360aa

  • AA Sequence

    AAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKK ISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLME TDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDL KICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCI LAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKN KVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIA EAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

  • Molecular Weight

    44.6kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAPK1, also known as ERK2 (Extracellular-signal-Regulated Kinase 2), is a crucial protein kinase that plays a vital role in various cellular processes, including cell proliferation, differentiation, and survival. It is a key component of the MAPK (Mitogen-Activated Protein Kinase) signaling pathway, which transmits extracellular signals from growth factors and stress to the nucleus, thereby influencing gene expression. Dysregulation of MAPK1 has been implicated in several diseases, particularly cancer, where aberrant signaling contributes to tumorigenesis and metastasis. Research into MAPK1 recombinant proteins has gained significant attention as scientists seek to understand its intricate roles in cellular signaling mechanisms and its potential as a therapeutic target. By producing and studying recombinant MAPK1, researchers can investigate its biochemical properties, interaction with other signaling molecules, and its impact on various cellular outcomes. Additionally, understanding the structure-function relationship of MAPK1 can aid in the design of specific inhibitors or modulators that could be useful in clinical settings. This research not only enriches our understanding of cellular signaling but also paves the way for the development of innovative treatments for diseases associated with MAPK1 dysregulation.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US