Analytical Data
-
Gene name
map
- Application
-
Alternative Names
MAP4;Microtubule-associated Protein 4
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AE18
-
Expression Region
1-264aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAISIKTPEDIEKMRVAGRLAAEVLEMIEP YVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHG IPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQ ESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSL SAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on MAP (microtubule-associated protein) recombinant proteins has gained significant attention due to their crucial role in cellular processes, particularly in neurons, where they are involved in the stabilization of microtubules and the regulation of neurofilament organization. MAPs, such as tau, are key regulators of microtubule dynamics, affecting cellular structure and intracellular transport. Dysregulation of MAPs is linked to various neurodegenerative diseases, including Alzheimer's disease, where hyperphosphorylated tau protein forms neurofibrillary tangles. To better understand their function and implications in disease, scientists have developed recombinant MAP proteins, allowing for detailed studies of their biophysical properties, interactions, and effects on microtubule assembly. Utilizing recombinant technology enables researchers to manipulate these proteins for experimental purposes, providing insights into their role in cellular contexts and the potential for therapeutic interventions. The ability to produce MAPs in vitro also facilitates high-throughput screening for molecules that can modulate their activity, advancing our understanding of their biological significance and paving the way for drug discovery targeting MAP-related pathologies.
