Analytical Data
-
Gene name
Fos
- Application
-
Alternative Names
Fos；G0S7；Protein c-Fos
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01100
-
Expression Region
1-380aa
-
AA Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
-
Molecular Weight
45.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The Fos protein, part of theActivator Protein-1 (AP-1) transcription factor family, plays a critical role in many cellular processes, including proliferation, differentiation, and apoptosis. First identified as an immediate early gene product in response to mitogenic stimuli, Fos interacts with other proteins, particularly Jun family members, to form homo- or heterodimers that regulate gene expression in various biological contexts. Research into Fos and its related signaling pathways has significantly advanced our understanding of cellular responses to stress, growth factors, and oncogenic signals, highlighting its potential as a biomarker in cancer and other diseases. As aberrant Fos expression has been linked to tumorigenesis, studying recombinant Fos proteins allows scientists to dissect its molecular mechanisms and explore therapeutic interventions. Additionally, Fos serves as a valuable model for investigating protein-protein interactions and gene regulation. Recent advances in biotechnology have enabled researchers to produce and characterize recombinant Fos proteins more efficiently, paving the way for innovative applications in drug design and development. Overall, the study of Fos recombinant proteins provides essential insights into cellular dynamics and holds promise for future therapeutic strategies targeting related diseases.
