Analytical Data
-
Gene name
T4
- Application
-
Alternative Names
T4;ILTMP;Transmembrane 4 L6 family member 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48230
-
Expression Region
1-202aa
-
AA Sequence
MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV
-
Molecular Weight
21.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
T4 recombinants, derived from the T4 bacteriophage, have garnered significant attention in molecular biology due to their unique properties and versatility in various applications. T4 phage, a virus that infects Escherichia coli, serves as a model system for understanding viral replication and protein engineering. Researchers have leveraged T4’s well-characterized genetics and robust replication machinery to develop recombinant proteins that can be utilized for therapeutic, diagnostic, and research purposes. The ability to manipulate the T4 genome allows scientists to insert foreign genes, resulting in the expression of proteins that can be difficult to produce using traditional means. Furthermore, T4 recombinants can exhibit high levels of stability and solubility, making them suitable for various industrial applications, including enzyme production and vaccine development. The ongoing advancements in synthetic biology and genome editing technologies, such as CRISPR/Cas9, have propelled T4 recombinant protein studies into new realms, allowing for precise modifications and the exploration of novel functions. Overall, T4 recombinant proteins represent a powerful tool in biotechnology, facilitating breakthroughs in both fundamental research and practical applications.











