Analytical Data
-
Gene name
KLHDC8A
- Application
-
Alternative Names
KLHDC8A; Kelch domain-containing protein 8A; Substitute for delta-EGFR expression 1; S-delta-E1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IYD2
-
Expression Region
1-350aa
-
AA Sequence
MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPMDCFEVYSPEADQWTALPRLPTARAGVAVTALGKRIMVIGGVGTNQLPLKVVEMYNIDEGKWKKRSMLREAAMGISVTAKDYRVYAAGGMGLDLRPHNHLQHYDMLKDMWVSLAPMPTPRYAATSFLRGSKIYVLGGRQSKYAVNAFEVFDIETRSWTKFPNIPYKRAFSSFVTLDNHLYSLGGLRQGRLYRQPKFLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRVIVAGGLGNQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The KLHDC8A protein, a member of the kelch-like gene family, has garnered significant attention in recent years due to its potential roles in various biological processes and disease mechanisms. This protein is characterized by its unique structure, which includes multiple kelch repeats, typically involved in protein-protein interactions, suggesting a key function in cellular signaling and cytoskeletal organization. Studies have shown that KLHDC8A may be implicated in the regulation of cellular responses to stress and inflammation, making it potentially relevant in the context of neurological disorders and immune responses. Additionally, emerging evidence points to its involvement in the development and progression of certain cancers, as it appears to influence cell proliferation and apoptosis. As the understanding of KLHDC8A’s physiological roles expands, there is a growing interest in exploring its potential as a biomarker for disease diagnosis and prognosis, as well as a therapeutic target. Consequently, research efforts are focused on characterizing the molecular mechanisms underlying its functions, elucidating its interactions with other cellular components, and investigating its expression patterns in various tissues and disease states. This multifaceted approach aims to solidify KLHDC8A's significance in medical research, ultimately contributing to the development of innovative diagnostic and therapeutic strategies.
