Analytical Data
-
Gene name
RPS4Y1
- Application
-
Alternative Names
RPS4Y1；RPS4Y；Small ribosomal subunit Protein eS4. Y isoform 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22090
-
Expression Region
1-263aa
-
AA Sequence
MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
-
Molecular Weight
36.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RPS4Y1, a gene located on the Y chromosome, encodes a ribosomal protein that is vital for ribosome biogenesis and protein synthesis. It has garnered considerable attention due to its unique role in male-specific mechanisms of gene expression and its involvement in spermatogenesis. Research has shown that mutations or dysregulation of RPS4Y1 are associated with male infertility, highlighting its significance in reproductive health. As a component of the ribosomal machinery, RPS4Y1 is crucial for the proper formation of ribosomes, which are essential for translating mRNA into proteins. The study of RPS4Y1 not only enhances our understanding of the molecular mechanisms underlying male reproduction and fertility but also provides insights into the evolutionary aspects of Y chromosome genes. Given the increasing prevalence of male infertility, elucidating the function and regulation of RPS4Y1 may offer potential avenues for therapeutic interventions. Advances in recombinant protein technology allow researchers to produce and study RPS4Y1 in vitro, facilitating the exploration of its structural properties and interactions with other cellular components. Overall, the investigation of RPS4Y1 holds promise for both basic biological research and clinical applications in addressing male reproductive disorders.
