Analytical Data
-
Gene name
MAD2L1
- Application
-
Alternative Names
MAD2L1BP;CMT2;KIAA0110;MAD2L1-binding Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13257
-
Expression Region
1-205aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMALQLSREQGITLRGSAEIVAEFFSFGINS ILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCS VQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRS VIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE VRLRSFTTTIHKVNSMVAYKIPVND
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAD2L1 (MITOTIC ARREST DEFICIENT 2-LIKE 1) is a crucial protein that plays a vital role in the spindle assembly checkpoint (SAC), a mechanism that ensures proper chromosome segregation during cell division. Dysfunction or dysregulation of MAD2L1 has been implicated in various cancers, as it can lead to aneuploidy, a condition characterized by an abnormal number of chromosomes. The study of recombinant MAD2L1 protein has gained increasing attention in the field of cancer biology and therapy, as understanding its structure and function could provide insights into its role in SAC and cellular proliferation. Researchers have focused on producing recombinant MAD2L1 to investigate its interactions with other checkpoint proteins, such as CDC20 and APC/C, and to explore its potential as a target for cancer therapeutics. By elucidating the molecular mechanisms underlying MAD2L1 function, scientists aim to identify novel strategies for restoring proper cell cycle regulation in tumor cells, enhancing the efficacy of existing treatments, and potentially developing new anti-cancer agents. Furthermore, structural studies of recombinant MAD2L1 using techniques such as X-ray crystallography and NMR spectroscopy offer valuable information about its conformational states and binding dynamics, paving the way for the design of small molecules that can modulate its activity. Overall, research on recombinant MAD2L1 not only enhances our basic understanding of mitotic checkpoints but also holds therapeutic promise for improving cancer treatment outcomes.
