Cat: PA2000-354DB

Recombinant Human IL11Ra Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL11Ra

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL11Ra;Interleukin-11 receptor subunit alpha

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14626

  • Expression Region

    1-422aa

  • AA Sequence

    MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPG VTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGA LGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRK KTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNP LGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQP HFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSL QPHPRLLDHRDSVEQVAVLASLGTLSFLGLVAGALALGLWLRLRRGGKDG SPKPGFLASVIPVDRRPGAPNL

  • Molecular Weight

    72 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-11 receptor (IL-11Ra) is a crucial component of the interleukin-11 signaling pathway, which plays a significant role in mediating inflammatory responses and regulating various physiological processes, including hematopoiesis and fibrosis. The study of IL-11Ra has garnered interest in the context of various diseases, particularly those associated with chronic inflammation and tissue remodeling, such as idiopathic pulmonary fibrosis, inflammatory bowel disease, and certain cancers. Research indicates that IL-11 signaling can contribute to the promotion of fibrosis and the maintenance of pathological inflammation. By understanding the structure and function of the IL-11Ra, researchers aim to develop targeted therapies that can inhibit its signaling pathway, potentially leading to new treatment strategies for diseases characterized by excessive fibrosis and inflammation. Recombinant IL-11Ra proteins are essential for these studies, allowing for the exploration of receptor interactions, the elucidation of downstream signaling mechanisms, and the screening of small molecules or antibodies that can modulate its activity. Continued exploration of IL-11Ra and its biological implications holds promise for advancing therapeutic options and improving clinical outcomes in patients suffering from fibrotic and inflammatory conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US