Cat: PA1000-1774

Recombinant Human LASP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LASP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LASP1;MLN50;LIM and SH3 domain Protein 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q14847

  • Expression Region

    1-261aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMNPNCARCGKIVYPTEKVNCLDKFWH KACFHCETCKMTLNMKN YKGYEKKPYCNAHYPKQSFTMVADTPENLRL KQQSELQSQVRYKEEFEKNKGKGFSVVADTPELQRI KKTQDQISNIKY HEEFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQ QPQQQ PVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDE VSFQDGDTIVNVQQIDDGWMYGTV ERTGDTGMLPANYVEAI

  • Molecular Weight

    32 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LASP1 (Limestone and Spleen Protein 1) is a protein that has garnered significant interest in biomedical research due to its association with various cellular functions and diseases, particularly in cancer. It is a cytoskeletal protein that interacts with actin filaments and is involved in cellular processes such as migration, adhesion, and proliferation. High levels of LASP1 expression have been correlated with tumor progression and metastasis in several cancer types, making it a potential biomarker and therapeutic target. Researchers are particularly focused on generating recombinant LASP1 proteins to study their structural and functional properties, enabling a better understanding of how this protein contributes to disease mechanisms at the molecular level. Studies utilizing LASP1 recombinant proteins are also aiding in the identification of potential inhibitors or modulators that might interfere with its interaction in pathological contexts. The exploration of LASP1's role in cell signaling pathways further underlines its importance in cancer biology, positioning it as a candidate for future drug development strategies aimed at targeting specific cancer pathways. Through these efforts, the scientific community aims to unravel the complexities of LASP1's functionality and its impact on tumor behavior, which may lead to improved diagnostic and therapeutic approaches for cancer treatment.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US