Analytical Data
-
Gene name
HMWK
- Application
-
Alternative Names
HMWK；BDK；KNG；Kininogen-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01042
-
Expression Region
390-639aa
-
AA Sequence
SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDL
-
Molecular Weight
31.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HMWK (High-Molecular-Weight Kininogen) is a key plasma protein involved in various physiological processes, including inflammation, blood coagulation, and the kinin-generating pathway. Research into HMWK has gained traction due to its critical role in the kallikrein-kinin system, which regulates blood pressure and vascular permeability. Mutations or deficiencies in HMWK can lead to several pathological conditions, including hereditary angioedema, thrombosis, and other cardiovascular disorders. Scientists have focused on recombinant HMWK protein for therapeutic applications, as it allows for a controlled study of its functions and a potential avenue for treatment. The recombinant production of this protein facilitates the exploration of its structure-function relationships and enables the development of novel therapeutics that can modulate its activity. Additionally, understanding HMWK interactions with its receptors and downstream signaling pathways could lead to innovative strategies for managing diseases associated with dysregulation of the kinin system. This research not only advances our comprehension of HMWK's biological roles but also holds promise for addressing clinical challenges linked to its dysfunction.
