Analytical Data
-
Gene name
Ect4
- Application
-
Alternative Names
Ect4；YTH domain-containing Protein ECT4
-
Species
Drosophila melanogaster
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6IDD9
-
Expression Region
370-678aa
-
AA Sequence
KSQYLEKINEVIRRAWAVPTHGHELGYSLCNSLRQSGGLDLLMKNCVKPDLQFSSAQLLEQCLTTENRKHVVDNGLDKVVNVACVCTKNSNMEHSRVGTGILEHLFKHSEGTCSDVIRLGGLDAVLFECRTSDLETLRHCASALANLSLYGGAENQEEMILRKVPMWLFPLAFHNDDNIKYYACLAIAVLVANKEIEAEVLKSGCLDLVEPFVTSHDPSAFARSNLAHAHGQSKHWLKRLVPVLSSNREEARNLAAFHFCMEAGIKREQGNTDIFREINAIEALKNVASCPNAIASKFAAQALRLIGET
-
Molecular Weight
41.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ect4, a member of the Ect family of proteins, has garnered attention in recent years due to its potential implications in various biological processes and diseases. Initially identified in the context of its role in bacterial cell physiology, Ect4 is believed to be involved in critical cellular functions such as cell signaling, metabolism, and stress responses. Research indicates that Ect4 may have significant implications in regulating the immune response and maintaining cellular homeostasis, making it a target of interest for therapeutic interventions. Moreover, studies have suggested that Ect4 may play a role in certain pathological conditions, including cancer and inflammatory diseases, prompting further investigation into its structural and functional properties. The recombinant expression of Ect4 provides a valuable platform for dissecting its biological functions and mechanisms of action. By producing Ect4 as a recombinant protein, researchers can explore its interactions with other cellular molecules and gain insights into its role in health and disease. Understanding the molecular basis of Ect4's function is essential for elucidating its potential as a biomarker or therapeutic target, paving the way for novel approaches in treating diseases associated with dysregulated Ect4 expression. Overall, the exploration of Ect4 recombinant protein represents a significant advancement in our understanding of Ect family proteins and their diverse roles in cellular biology.
