Analytical Data
-
Gene name
P39
- Application
-
Alternative Names
P39；NCK5AI；Cyclin-dependent kinase 5 activator 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13319
-
Expression Region
1-367aa
-
AA Sequence
MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENLLRKGRDPPDGGGTAKPLAVPVPTVPAAAATCEPPSGGSAAAQPPGSGGGKPPPPPPPAPQVAPPVPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLLQGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPLKPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASGGGPPSGGAPAASSAARDSCAAGTKHWTMNLDR
-
Molecular Weight
38.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
P39 recombinant protein has garnered significant attention in recent years due to its potential applications in various fields, including immunology and vaccine development. This protein, derived from pathogenic microorganisms, plays a crucial role in modulating host immune responses. Studies have indicated that P39 may enhance antigen presentation and stimulate both humoral and cellular immune responses, making it a promising candidate for use in therapeutic vaccines against infectious diseases and cancer. The structural characteristics of P39, combined with its ability to interact with immune cells, have led researchers to investigate its mechanisms of action in greater detail. Additionally, the production of P39 as a recombinant protein allows for the generation of large quantities suitable for both in vitro and in vivo studies, facilitating comprehensive exploration of its immunological properties. Moreover, understanding the biological functions of P39 could provide insights into the development of novel immunotherapeutics. Furthermore, ongoing research aims to elucidate the specific pathways through which P39 exerts its effects and to assess its efficacy in preclinical models, paving the way for future clinical applications. As a result, P39 recombinant protein represents a vital focus for researchers striving to innovate in the realms of disease prevention and treatment.
