Analytical Data
-
Gene name
KIAA1199
- Application
-
Alternative Names
CEMIP; KIAA1199; Cell migration-inducing and hyaluronan-binding protein; EC 3.2.1.35
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WUJ3
-
Expression Region
880-979aa
-
AA Sequence
LYDGPINIQNCTFRKFVALEGRHTSALAFRLNNAWQSCPHNNVTGIAFEDVPITSRVFFGEPGPWFNQLDMDGDKTSVFHDVDGSVSEYPGSYLTKNDNW
-
Molecular Weight
36.74 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1199 is a protein that has garnered significant attention in recent years due to its potential roles in various biological processes and diseases, particularly in cancer. Initially identified as a gene of unknown function, KIAA1199 has been implicated in tumorigenesis and cancer progression, especially in colorectal cancer. Its expression is often dysregulated in cancer tissues, suggesting a role in promoting cell proliferation, migration, and invasion. Studies have shown that KIAA1199 can interact with components of the extracellular matrix and influence cellular signaling pathways, thereby affecting tumor microenvironment interactions. Additionally, the protein has been associated with the epithelial-mesenchymal transition (EMT), a critical process in cancer metastasis. Recent research indicates that KIAA1199 may also be involved in the biosynthesis and secretion of hyaluronic acid, a component that enhances tumor growth and metastasis. The investigation of KIAA1199 offers potential for developing novel therapeutic strategies and biomarkers for cancer diagnosis and prognosis. Given its multifaceted roles in cancer biology, ongoing studies are focused on elucidating the precise molecular mechanisms underlying its function and exploring its potential as a target for cancer therapy. Understanding the role of KIAA1199 in various cellular contexts may not only provide insights into its contributions to tumor behavior but also aid in the development of new intervention strategies in oncology.
