Analytical Data
-
Gene name
KIAA1191
- Application
-
Alternative Names
Brain-derived rescue factor p60MONOX; Flavin monooxygenase motif-containing protein of 33 kDa; FLJ21022; Hypothetical protein LOC57179 ; Kiaa1191; P33MX_HUMAN; P60MONOX ; Putative monooxygenase p33MONOX
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96A73
-
Expression Region
1-305aa
-
AA Sequence
MASRQPEVPALEASAPLGKMSLPIGIYRRAVSYDDTLEDPAPMTPPPSDMGSVPWKPVIPERKYQHLAKVEEGEASLPSPAMTLSSAIDSVDKVPVVKAKATHVIMNSLITKQTQESIQHFERQAGLRDAGYTPHKGLTTEETKYLRVAEALHKLKLQSGEVTKEERQPASAQSTPSTTPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGPRSLQKYDSGSFATQAYRGAQKPSPLELIRAQANRMAEDPAALKPPKMDIPVMEGKKQPPRAHNLKPRDLNVLTPTGF
-
Molecular Weight
59.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1191, also known as GIGYF2, is a protein that has garnered significant interest in the field of molecular biology due to its involvement in various cellular processes, including gene expression regulation and cell signaling pathways. Initially identified through large-scale genomic studies, KIAA1191 has been implicated in critical functions such as mRNA stability, translation repression, and the modulation of growth factor signaling. Recent research suggests that KIAA1191 interacts with the mTOR pathway, a crucial regulator of cell growth and metabolism, linking it to metabolic disorders and cancer progression. Additionally, its role in the cellular response to stress conditions underscores its potential as a biomarker for disease states. The recombinant form of KIAA1191 is particularly valuable for studying these interactions in vitro, allowing scientists to dissect its functional mechanisms and explore its therapeutic potential. As such, understanding the structure-function relationship of KIAA1191 through recombinant protein studies is essential for elucidating its role in health and disease, paving the way for novel interventions in related pathological conditions.
