Analytical Data
-
Gene name
KIAA1189
- Application
-
Alternative Names
ERM like protein; Ermin; ermin. ERM-like protein; ERMIN_HUMAN; Ermn; JN; Juxtanodin; KIAA1189
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TAM6
-
Expression Region
1-297aa
-
AA Sequence
MKTLSPDRIQPHIMTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSRYNTISYRKIRKGNTKQRIDEFESMMHL
-
Molecular Weight
60.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA1189, a gene located on chromosome 4, has garnered attention in recent years due to its potential roles in various biological processes, including cell proliferation, differentiation, and the regulation of gene expression. Initially identified through large-scale sequencing projects, KIAA1189 encodes a protein that is believed to be involved in cellular signaling pathways and may interact with several key regulatory proteins. Recent studies have implicated KIAA1189 in certain diseases, particularly in cancer development, suggesting that its dysregulation could contribute to tumorigenesis. Additionally, the protein has been linked to neurological conditions, prompting further investigation into its functional significance in the nervous system. Researchers are focused on understanding the precise molecular mechanisms by which KIAA1189 exerts its effects, utilizing techniques such as gene knockout models, overexpression studies, and protein-interaction assays. The exploration of KIAA1189's role in cellular contexts is expected to provide insights into its potential as a therapeutic target, particularly in cancer and neurodegenerative diseases, making it a significant focus of current molecular biology and biomedical research.
