Cat: PA1000-1759

Recombinant Human KRT17 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRT17

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KRT17;Keratin. type I cytoskeletal 17

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q04695

  • Expression Region

    1-432aa

  • AA Sequence

    MTTSIRQFTSSSSIKGSSGLGGGSSRTSCRLSGGLGAGSCRLGSAGGLGS TLGGSSYSSCYSFGSGGGYGSSFGGVDGLLAGGEKATMQNLNDRLASYLD KVRALEEANTELEVKIRDWYQRQAPGPARDYSQYYRTIEELQNKILTATV DNANILLQIDNARLAADDFRTKFETEQALRLSVEADINGLRRVLDELTLA RADLEMQIENLKEELAYLKKNHEEEMNALRGQVGGEINVEMDAAPGVDLS RIPNEMRDQYEKMAEKNRKDAEDWFFSKTEELNREVATNSELVQSGKSEI SELRRTMQALEIELQSQLSMKASLEGNLAETENRYCVQLSQIQGLIGSVE EQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLTQYKK EPVTTRQVRTIVEEVQDGKVISSREQVHQTTR

  • Molecular Weight

    73 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRT17, or Keratin 17, is a member of the keratin family and plays a crucial role in epithelial differentiation and integrity. Its expression has been linked to various physiological and pathological processes, including wound healing, skin disorders, and carcinogenesis. Research has shown that KRT17 is upregulated in response to cellular stress and injury, indicating its involvement in the repair mechanisms of epithelial tissues. Abnormal expression of KRT17 has been associated with several types of cancer, particularly squamous cell carcinoma, where it may contribute to tumor progression and metastasis. The investigation of KRT17 as a potential biomarker for cancer diagnosis and prognosis has garnered significant attention. Additionally, understanding its role in keratinocyte biology and its interaction with signaling pathways could provide insights into novel therapeutic strategies for skin-related diseases and cancer treatments. The recombination of KRT17 protein offers promising avenues for experimental studies, enabling researchers to elucidate its functional mechanisms and assess its potential in clinical applications. Overall, the multifaceted role of KRT17 in health and disease makes it a focal point of current biomedical research, aimed at unlocking new diagnostic and therapeutic possibilities.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US