Analytical Data
-
Gene name
bioH
- Application
-
Alternative Names
bioH；bioB；Pimeloyl-[acyl-carrier Protein] methyl ester esterase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13001
-
Expression Region
1-256aa
-
AA Sequence
MNNIWWQTKGQGNVHLVLLHGWGLNAEVWRCIDEELSSHFTLHLVDLPGFGRSRGFGALSLADMAEAVLQQAPDKAIWLGWSLGGLVASQIALTHPERVQALVTVASSPCFSARDEWPGIKPDVLAGFQQQLSDDFQRTVERFLALQTMGTETARQDARALKKTVLALPMPEVDVLNGGLEILKTVDLRQPLQNVSMPFLRLYGYLDGLVPRKVVPMLDKLWPHSESYIFAKAAHAPFISHPAEFCHLLVALKQRV
-
Molecular Weight
35.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BioH, or bioactive histidine-rich protein, is a recombinant protein that has garnered significant attention in biomedical research due to its potential therapeutic applications. It is derived from bioactive peptides that are rich in histidine, a crucial amino acid involved in various physiological functions, including metal ion binding and enzymatic activity. The study of BioH is rooted in its capacity to influence numerous biological processes, such as immune response modulation, cell signaling, and antioxidant activity. Recent advances in recombinant DNA technology have enabled the production of BioH with enhanced purity and yield, making it a valuable candidate for drug development and clinical applications. Researchers are exploring its role in various diseases, including cancer, neurodegenerative disorders, and metabolic syndromes, highlighting its multifunctional properties. The ongoing investigation into the structure-function relationship of BioH aims to unlock its full potential, paving the way for novel therapeutic strategies. As such, understanding the molecular mechanisms underlying BioH's action is crucial for harnessing its benefits in medical science, ultimately contributing to the development of targeted therapies and improving patient outcomes.
