Cat: PA1000-1729

Recombinant Human KLF4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KLF4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KLF4;EZF;GKLF;Krueppel-like factor 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O43474-1

  • Expression Region

    1-479aa

  • AA Sequence

    MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSH MKRLPPVLPGRPYDLAAATVATDLESGGAGAACGGSNLAPLPRRETEEFN DLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSF TYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFV AELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISV SKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS FLPDQMQPQVPPLHYQELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDY AGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH TGHRPFQCQKCDRAFSRSDHLALHMKRHFESGGGGSPGRRRRRRRRRRR

  • Molecular Weight

    53 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KLF4, or Kruppel-like factor 4, is a crucial transcription factor involved in various biological processes, including cell differentiation, proliferation, and maintaining pluripotency in stem cells. Its role in regulating gene expression makes it a significant focus of biological research, particularly in developmental biology and regenerative medicine. KLF4 is known to play a key role in the reprogramming of somatic cells into induced pluripotent stem cells (iPSCs), making it a vital component in research related to cellular reprogramming and therapeutic applications. Additionally, KLF4 has been implicated in various diseases, including cancer, where it may function as a tumor suppressor or oncogene depending on the context. This dual role highlights the complexity of KLF4's function in cell biology. The development of recombinant KLF4 protein has facilitated in-depth studies of its structure, function, and interactions with other molecular partners. Researchers utilize KLF4 recombinant proteins to investigate its mechanism of action, potential binding partners, and downstream effects in cellular processes. Furthermore, understanding KLF4's role in pathological conditions could pave the way for novel therapeutic interventions, particularly in cancer therapy and regenerative medicine. Consequently, the study of KLF4, especially through the lens of recombinant protein technology, is a burgeoning field that promises to enhance our understanding of cellular mechanisms and contribute to the advancement of medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US