Cat: PA1000-1719

Recombinant Human KIAA0513 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KIAA0513

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KIAA0513;Uncharacterized Protein KIAA0513

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O60268-3

  • Expression Region

    1-401aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMETPEVPVGSLIDFGPEAPTSSPLEAP PPVLQDGDGSLGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNES FSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSS ENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGP AKNLMTMCFTYYHIGKPQLLPPESREKPAGSIDSYLKSANSWLAEKKDIA ERLLKNTSARTENVKGFFGGLETKLKGPLARRNEEDENKPQEKRPRAVTA YSPEDEKKGEKIYLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTR EKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQ AVIGNLDEEQYKLLSDHIEQMATE

  • Molecular Weight

    48 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KIAA0513 is a gene that encodes a protein implicated in various biological processes, including cell signaling, proliferation, and differentiation. Identified through genomic studies, KIAA0513 has garnered attention due to its potential role in cancer biology, particularly in how it may influence tumor growth and metastasis. Its expression patterns have been observed to vary in different tissues, suggesting a role in tissue-specific functions and disease states. Recent research has focused on the functional characterization of KIAA0513 to elucidate its mechanisms in cellular pathways and understand how its dysregulation may contribute to oncogenesis. The recombinant KIAA0513 protein enables researchers to study its structural properties, interactions with other cellular proteins, and effects on cellular behavior. By generating and purifying this recombinant protein, scientists aim to unravel its biological significance and explore its potential as a therapeutic target in cancer treatment. Understanding KIAA0513's role at the molecular level could lead to novel diagnostic and therapeutic strategies in oncology, making it a key focus in the ongoing exploration of cancer biology and novel biomarker development.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US