Analytical Data
-
Gene name
KIAA0101
- Application
-
Alternative Names
PCLAF;KIAA0101;NS5ATP9;PAF;PCNA-associated factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15004
-
Expression Region
1-111aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMVRTKADSVPGTYRKVVAARAPRKVLG SSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSE KENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
-
Molecular Weight
14 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIAA0101, also known as PTIP (p53-regulated transcriptional intermediary factor), is a protein that has gained considerable attention in molecular biology and cancer research due to its implications in DNA repair, cell cycle regulation, and tumorigenesis. The gene encoding KIAA0101 is located on chromosome 14 and plays a significant role in mediating the response to DNA damage by facilitating the recruitment of repair factors to sites of DNA lesions. Its interaction with various proteins, including those involved in the p53 pathway, underscores its potential role as a regulatory hub in cellular stress responses. Dysregulation of KIAA0101 has been implicated in several cancers, making it a candidate for further exploration as a biomarker for tumor progression and a potential target for therapeutic intervention. Recent studies have focused on elucidating the structural and functional aspects of KIAA0101, particularly its recombinantly expressed forms, to better understand its mechanistic roles in cellular processes and its contribution to oncogenesis. This research aims not only to clarify the biological functions of KIAA0101 but also to explore its potential as a therapeutic target in cancer treatment, offering prospects for novel strategies in oncotherapy. Additionally, KIAA0101’s involvement in maintaining genomic integrity positions it as a vital component in the study of cancer biology, highlighting the need for continued research to fully unravel its contributions to cellular physiology and pathology.











