Analytical Data
-
Gene name
EXPA1
- Application
-
Alternative Names
EXPA1；EXP1；Expansin-A1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7XWU8
-
Expression Region
1-261aa
-
AA Sequence
MAGSSAATSCARFLALLATCLLWNEAASFTASGWNKAFATFYGGSDASGTMGGACGYGDLYSTGYGTNTAALSTVLFNDGASCGQCYRIMCDYQADRRFCISGTSVTITATNLCPPNYALPNDAGGWCNPPRQHFDMAEPAWLKIGVYVGGIVPVMYQRVPCAKQGGVRFTINGRDYFELVLVSNVGGVGSIQSVSIKGSRTGWMAMSRNWGVNWQSNAYLDGQSLSFKVTSSDGQTLTFLDVAPAGWTFGQTFSTSQQFS Keywords
-
Molecular Weight
27.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
EXPA1, a member of the expansin protein family, is primarily involved in cell wall remodeling and expansion in plants. The study of EXPA1 is crucial as it plays a significant role in various growth processes, including cell elongation, seed germination, and fruit development. EXPAs are characterized by their ability to disrupt hydrogen bonds in the cell wall polysaccharides, facilitating cell wall extension and softening. Recent research has highlighted the importance of EXPA1 in modulating plant responses to environmental stressors, such as drought and salinity, through its influence on cell wall properties. Understanding the molecular mechanisms by which EXPA1 interacts with other proteins and its regulation under different physiological conditions can provide insights into enhancing plant growth and resilience. Additionally, the recombinant production of EXPA1 offers a promising avenue for biotechnological applications, including crop improvement and the development of more sustainable agricultural practices. By delving into the structure-function relationship of EXPA1, researchers aim to uncover its potential in optimizing plant performance in adverse environmental scenarios, ultimately contributing to food security and agricultural sustainability. This ongoing research holds significant promise for developing strategies to engineer crops with improved adaptability to changing climatic conditions.
