Analytical Data
-
Gene name
KIR2DL5B
- Application
-
Alternative Names
KIR2DL5B；CD158F；CD158F2；KIR2DL5；Killer cell immunoglobulin-like receptor 2DL5B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NHK3
-
Expression Region
22-238aa
-
AA Sequence
HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVDGTFQADFPLGPATHGGTYTCFSSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH
-
Molecular Weight
30.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL5B is a member of the killer immunoglobulin-like receptor (KIR) family, which plays a critical role in the immune response by regulating natural killer (NK) cell activity. It is primarily expressed on NK cells and certain T cell subsets, and its interaction with HLA class I molecules is essential for maintaining immune tolerance and modulating the activation state of immune cells. The study of KIR2DL5B, particularly in the context of autoimmune diseases and cancer, has gained significant attention due to its potential as a therapeutic target and biomarker. Recent research indicates that KIR2DL5B may influence the proliferation and cytotoxicity of NK cells, thereby impacting tumor surveillance and immune response dynamics. Recombinant protein studies are pivotal in unraveling the biochemical properties, ligand-binding capabilities, and downstream signaling pathways associated with KIR2DL5B. Understanding these mechanisms may lead to novel strategies for enhancing anti-tumor immunity and improving outcomes in immunotherapy. This exploration is further underscored by the genetic variability present in KIR genes, which can affect individual responses to diseases and treatments. Consequently, detailed investigations into the role of KIR2DL5B as a recombinant protein could provide valuable insights into its function, paving the way for innovative approaches in treating various malignancies and enhancing the efficacy of immune therapies. As research progresses, it is anticipated that comprehensive studies will clarify the importance of KIR2DL5B within the broader context of immune regulation and its potential implications in clinical applications.
