Analytical Data
-
Gene name
JOSD1
- Application
-
Alternative Names
TAF1D;JOSD3;TATA box-binding Protein-associated factor RNA polymerase I subunit D
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q15040
-
Expression Region
1-202aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMVTPHKKSMLGNGNYDVNVIMAALQTK GYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVR EVGGAYYNLDSKLMSCVPWKGDKAKSESLELPQAAPPQIYHEKQRRELCA LHALNNVFQDSNAFTRDTLQEIFQRLSPNTKMPEWIGGESELRKFLKHHL RGKNCELLLVVPEEVEAHQSWRTDV
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JOSD1 (Jumonji/ARID Domain-Containing Protein 1) is a member of the Jumonji domain-containing protein family, which plays a crucial role in various biological processes, including epigenetic regulation, cell differentiation, and development. Recent studies have highlighted its involvement in modulating histone methylation, thereby affecting gene expression and cellular responses. Abnormal expression or mutations in JOSD1 have been linked to several diseases, particularly cancers, suggesting that it may serve as a potential biomarker for diagnosis and a target for therapeutic interventions. The recombinant protein of JOSD1 is being researched to better understand its structure-function relationship and interactions within cellular contexts. Producing JOSD1 as a recombinant protein allows for the exploration of its biochemical properties, stability, and functional mechanisms. This research could also facilitate high-throughput screening for small molecules that can modulate JOSD1 activity, paving the way for novel treatment strategies. Overall, JOSD1's role in epigenetic regulation makes it a significant focus of scientific inquiry, meriting further exploration through the development of recombinant proteins for functional studies and potential clinical applications.
