Analytical Data
-
Gene name
KIR2DL5A
- Application
-
Alternative Names
KIR2DL5A;CD158F;CD158F1;KIR2DL5;Killer cell immunoglobulin-like receptor 2DL5A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N109
-
Expression Region
22-238aa
-
AA Sequence
HEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSLYKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGLFGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADFPLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRH
-
Molecular Weight
30.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KIR2DL5A, a member of the killer immunoglobulin-like receptor (KIR) family, plays a pivotal role in immune regulation and the recognition of human leukocyte antigen (HLA) class I molecules. The KIR genes are known for their significant involvement in modulating the activity of natural killer (NK) cells, influencing both innate and adaptive immune responses. KIR2DL5A is particularly interesting due to its association with various diseases, including viral infections and hematological malignancies, highlighting its potential as a therapeutic target. Research on recombinant KIR2DL5A protein is crucial for understanding its structural features, ligand interactions, and signaling pathways. By producing and characterizing this recombinant protein, scientists aim to elucidate the functional properties of KIR2DL5A, assess its role in NK cell activation, and explore its implications in immune surveillance and tolerance mechanisms. Furthermore, studying KIR2DL5A could provide insights into the evolution of KIR receptors and their varying impacts on human health across different populations. Overall, the investigation of KIR2DL5A, through recombinant protein studies, offers a promising avenue for advancing our knowledge of immune responses and developing novel immunotherapeutic strategies.











