Analytical Data
-
Gene name
KHDRBS2
- Application
-
Alternative Names
KH domain containing; RNA binding; signal transduction associated protein 2; 6330586C16Rik; bA535F17.1; FLJ38664; hSLM 1; hSLM-1; KH domain containing; RNA binding; signal transduction associated 2; KH domain-containing; KHDR2_HUMAN; khdrbs2; MGC26664; RNA-binding; Sam68 like mammalian protein 1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VWX1
-
Expression Region
1-349aa
-
AA Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTSSSLKAPPQRSARGGYREHPYGRY
-
Molecular Weight
65.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KHDRBS2, also known as KH domain containing, RNA binding, signal transduction associated 2, is a member of the KH domain-containing protein family, which plays a critical role in RNA metabolism and regulation. This protein has garnered attention due to its involvement in various cellular processes, including mRNA splicing, stability, and translation, as well as its potential connections to cancer and other diseases. Previous studies have indicated that KHDRBS2 can interact with other RNA-binding proteins and participate in the formation of ribonucleoprotein complexes, thereby influencing gene expression at the post-transcriptional level. The study of KHDRBS2 recombinant protein focuses on its structural and functional characterization, which can provide insights into its mechanisms of action and interactions within the cellular milieu. By examining the recombinant form of KHDRBS2, researchers aim to elucidate its binding affinities to RNA and other molecular partners, helping to clarify its role in cellular signaling pathways and disease progression. Understanding KHDRBS2 could pave the way for novel therapeutic strategies targeting RNA-binding proteins in disease contexts, particularly in cancers where dysregulation of RNA processing is implicated. This research is essential for advancing our knowledge of the intricate regulatory networks that govern gene expression and could ultimately contribute to the development of innovative treatments for diseases associated with aberrant RNA metabolism.
