Analytical Data
-
Gene name
PFD0110w
- Application
-
Alternative Names
PFD0110w；NBP1；Reticulocyte-binding Protein homolog 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P86148
-
Expression Region
24-269aa
-
AA Sequence
QESYSSNEKIRKDYSDDNNYEPTPSYEKRKKEYGKDESYIKNYRGNNFSYDLSKNSSIFLHMGNGSNSKTLKRCNKKKNIKTNFLRPIEEEKTVLNNYVYKGVNFLDTIKRNDSSYKFDVYKDTSFLKNREYKELITMQYDYAYLEATKEVLYLIPKDKDYHKFYKNELEKILFNLKDSLKLLREGYIQSKLEMIRIHSDIDILNEFHQGNIINDNYFNNEIKKKKEDMEKYIREYNLYIYKYENQ
-
Molecular Weight
30.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PFD0110w is a recombinant protein derived from the parasite Plasmodium falciparum, which is responsible for the most severe form of malaria in humans. Research on PFD0110w is significant due to its potential role in disease pathogenesis and its implications for vaccine development. The protein is part of the parasite's arsenal for immune evasion, playing a crucial role in the interaction between the parasite and the host's immune system. Understanding the structure and function of PFD0110w can reveal insights into the mechanisms of malaria infection and provide targets for therapeutic intervention. Moreover, the recombinant expression of PFD0110w allows for the generation of antibodies that can be useful for diagnostic purposes as well as for further investigating the immune response elicited during malaria infections. Given the global burden of malaria, with millions of cases and fatalities reported annually, characterizing proteins like PFD0110w is critical for advancing preclinical and clinical strategies aimed at controlling and ultimately eradicating malaria. Researchers are focusing on elucidating its role in pathogenesis, assessing its immunogenicity, and exploring its potential as a candidate for a malaria vaccine, which could contribute to long-term solutions against this persistent public health threat.
