Analytical Data
-
Gene name
KDELR1
- Application
-
Alternative Names
KDELR1; ERD2.1; ER lumen protein-retaining receptor 1; KDEL endoplasmic reticulum protein retention receptor 1; KDEL receptor 1; Putative MAPK-activating protein PM23
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P24390
-
Expression Region
1-212aa
-
AA Sequence
MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYNTCMKVVYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILWTFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA
-
Molecular Weight
50.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KDELR1, or KDEL Receptor 1, is a crucial protein involved in the retention of soluble proteins within the endoplasmic reticulum (ER). Its primary function is to recognize and bind to proteins that carry the KDEL sequence, a retrieval motif that signals for their return to the ER from the Golgi apparatus. Understanding the role of KDELR1 is essential in cellular biology, as it plays a significant part in maintaining protein homeostasis and the proper functioning of the secretory pathway. Dysregulation of KDELR1 has been implicated in various diseases, including neurodegenerative disorders and certain cancers, where improper protein retention and trafficking can lead to cellular stress and dysfunction. Recent studies have focused on the structural and functional characterization of KDELR1, exploring its interactions with KDEL-proteins and other cellular components. This research not only sheds light on KDELR1’s specific mechanisms but also holds promise for therapeutic targets in diseases associated with ER stress and protein misfolding. Advancing the understanding of KDELR1 can potentially lead to innovative strategies for enhancing cellular protein quality control and improving outcomes in related pathological conditions.
