Cat: PA2000-4493

Recombinant Human TNFRSF11B Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TNFRSF11B

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TNFRSF11B;OCIF;OPG;Tumor necrosis factor receptor superfamily member 11B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O00300

  • Expression Region

    22-401aa

  • AA Sequence

    ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

  • Molecular Weight

    73.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TNFRSF11B, also known as osteoprotegerin (OPG), is a member of the tumor necrosis factor receptor superfamily that plays a vital role in bone metabolism by regulating the differentiation and survival of osteoclasts, the cells responsible for bone resorption. Its primary function involves binding to receptor activator of nuclear factor-kappa B ligand (RANKL), thus inhibiting RANKL's ability to activate its receptor RANK on osteoclast precursors. This interaction is crucial in maintaining bone density and homeostasis, making OPG a significant target for understanding and treating various bone-related disorders, including osteoporosis, rheumatoid arthritis, and certain cancers that affect bone. The research surrounding recombinant TNFRSF11B protein has gained momentum in recent years due to its potential implications in therapeutic applications. By producing recombinant forms of OPG, researchers aim to explore its pharmacological properties, efficacy, and safety for use in clinical settings. This recombinant protein not only serves as a valuable tool for elucidating the mechanisms of osteoclast regulation but also provides insights into developing novel treatment strategies for conditions characterized by excessive bone resorption. Understanding the structure and function of TNFRSF11B further contributes to the advancement of bone health therapies, paving the way for improved interventions in metabolic bone diseases. As such, ongoing studies into the recombinant production and application of TNFRSF11B are crucial for both basic research and translational medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US