Analytical Data
-
Gene name
ISCU
- Application
-
Alternative Names
ISCU;NIFUN;Iron-sulfur cluster assembly enzyme ISCU
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H1K1
-
Expression Region
35-167aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMYHKKVVDHYENPRNVGSLDKTSKNVGTGL VGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKT VEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGE AEKK
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ISCU (Iron-Sulfur Cluster Assembly Protein) is a pivotal component in the biogenesis of iron-sulfur (Fe-S) clusters, essential cofactors in various cellular processes, including electron transport and enzymatic reactions. Research on ISCU has gained traction due to its significant role in mitochondrial function and cellular iron homeostasis. Deficiencies or mutations in ISCU can lead to severe mitochondrial disorders, neurodegenerative diseases, and other health complications. Understanding its structure and mechanism of action is critical for elucidating the pathways of Fe-S cluster assembly and their implications in human health. Recent studies have employed recombinant proteins to analyze ISCU's functionality in vitro, aiming to delineate how it interacts with other assembly factors and substrates. These investigations contribute to our understanding of metabolic diseases linked to iron-sulfur cluster deficiencies and may pave the way for therapeutic interventions targeting ISCU-related pathways.
