Analytical Data
-
Gene name
ACKR1
- Application
-
Alternative Names
ACKR1；DARC；FY；GPD；Atypical chemokine receptor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16570
-
Expression Region
1-336aa
-
AA Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
-
Molecular Weight
41.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACKR1, also known as atypical chemokine receptor 1, is a crucial molecule that has garnered significant attention in the field of immunology and cardiovascular research. This receptor is primarily known for its role in regulating chemokine signaling, which is vital for immune cell trafficking and homeostasis. Unlike traditional chemokine receptors, ACKR1 does not activate G-proteins but instead acts as a scavenger for certain chemokines, facilitating their clearance from the extracellular environment. This unique function plays a pivotal role in modulating inflammatory responses, and dysregulation of ACKR1 has been implicated in various pathological conditions, including autoimmune diseases, cancer, and cardiovascular disorders. Research has increasingly focused on the potential therapeutic applications of ACKR1, particularly in modulating immune responses and targeting the tumor microenvironment. The development of recombinant ACKR1 proteins has enabled scientists to investigate its structure-function relationships and interactions with chemokines in detail. Understanding these dynamics could pave the way for novel therapeutic strategies aimed at harnessing the immunomodulatory properties of ACKR1, making it a promising target for drug development in treating inflammatory and malignancy-related diseases.
