Cat: PA1000-1665

Recombinant initiation INFα1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    INFα1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    initiation

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q63W31

  • Expression Region

    1-88aa

  • AA Sequence

    MAKEELIELDGIVDEVLPDSRYRVTLDNGVVVGAYASGQMRRHRIRILAGDRVTLELSVYDLTKGRINFRHKDERRSDAAPRASARRR

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Recombinant interferon alpha 1 (INFα1) is a type of cytokine belonging to the interferon family, which plays a crucial role in the immune response against viral infections, tumors, and other pathological conditions. Research on INFα1 has gained traction due to its potential therapeutic applications, particularly in the treatment of chronic viral hepatitis, certain cancers, and multiple sclerosis. The recombinant form of INFα1 is produced using genetically engineered microorganisms, which allows for greater purity and consistency compared to natural extracts. Studies have shown that INFα1 exhibits antiviral, antiproliferative, and immunomodulatory effects, making it a candidate for enhancing immune responses in various clinical settings. Furthermore, advancements in biotechnology and molecular biology techniques have facilitated the optimization of recombinant protein expression, purification, and formulation, thus improving its efficacy and safety profile. As researchers continue to explore the mechanisms of action and therapeutic applications of INFα1, it remains at the forefront of immunotherapy and offers promise for improving patient outcomes in infectious diseases and malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US