Analytical Data
-
Gene name
BZW2
- Application
-
Alternative Names
BZW2；5MP1；eIF5-mimic Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6E2
-
Expression Region
1-419aa
-
AA Sequence
MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFDILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFLKAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKANLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYCYDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN
-
Molecular Weight
75.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
BZW2, or Basic Leucine-Zipper Nuclear Protein 2, is a member of the bZIP transcription factor family, which plays a critical role in regulating gene expression in response to various physiological stimuli. Research on BZW2 has gained momentum due to its involvement in several crucial biological processes, including cell proliferation, differentiation, and stress response. Recent studies have identified BZW2 as a key player in cellular pathways related to cancer development and progression, making it a potential target for therapeutic intervention. Its activity is modulated by various post-translational modifications, which influence its stability and interaction with other proteins. Furthermore, the role of BZW2 in metabolic regulation and its association with diseases such as obesity and diabetes highlights its importance in maintaining cellular homeostasis. Understanding the molecular mechanisms underlying BZW2 function and regulation can provide insights into its contribution to normal physiology and disease states. As research continues to uncover the complex interactions and regulatory networks involving BZW2, the development of recombinant BZW2 proteins for functional studies will facilitate a deeper understanding of its biological significance and potential applications in targeted therapies.
