Analytical Data
-
Gene name
VAPB
- Application
-
Alternative Names
VAPB；Vesicle-associated membrane Protein-associated Protein B/C
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95292
-
Expression Region
1-222aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMAKVEQVLSL EPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAK PEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSS LDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISA LAPTGKEEGLST
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
VAPB (Vamp-Associated Protein B) is a crucial protein involved in various cellular processes, including endoplasmic reticulum (ER) function, membrane trafficking, and neuronal survival. Research has identified VAPB as playing a significant role in neurodegenerative diseases, particularly in amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA), where mutations in the VAPB gene lead to impaired motor neuron function and degeneration. The VAPB protein interacts with several partners, such as the ER receptor STIM1 and the vesicle-associated membrane proteins (VAMPs), influencing calcium homeostasis and synaptic transmission. Due to its relevance in cellular health and disease, scientists are keen on characterizing VAPB through recombinant protein studies, which facilitate the examination of its structure-function relationships and interactions with other cellular components. By generating recombinant VAPB in various expression systems, researchers can analyze its biochemical properties, functional roles, and potential as a therapeutic target. This ongoing research not only enhances the understanding of the molecular mechanisms underlying neurodegenerative diseases but also opens avenues for developing strategies to restore normal function in affected neurons. As such, VAPB remains a focal point of study in neurology and cell biology, highlighting the intricate connections between protein function and disease pathology.
