Cat: PA2000-4449

Recombinant Human VAPB Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    VAPB

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    VAPB;Vesicle-associated membrane Protein-associated Protein B/C

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95292

  • Expression Region

    1-222aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMAKVEQVLSL EPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGI IDAGASINVSVMLQPFDYDPNEKSKHKFMVQSMFAPTDTSDMEAVWKEAK PEDLMDSKLRCVFELPAENDKPHDVEINKIISTTASKTETPIVSKSLSSS LDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISA LAPTGKEEGLST

  • Molecular Weight

    27 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

VAPB (Vamp-Associated Protein B) is a crucial protein involved in various cellular processes, including endoplasmic reticulum (ER) function, membrane trafficking, and neuronal survival. Research has identified VAPB as playing a significant role in neurodegenerative diseases, particularly in amyotrophic lateral sclerosis (ALS) and spinal muscular atrophy (SMA), where mutations in the VAPB gene lead to impaired motor neuron function and degeneration. The VAPB protein interacts with several partners, such as the ER receptor STIM1 and the vesicle-associated membrane proteins (VAMPs), influencing calcium homeostasis and synaptic transmission. Due to its relevance in cellular health and disease, scientists are keen on characterizing VAPB through recombinant protein studies, which facilitate the examination of its structure-function relationships and interactions with other cellular components. By generating recombinant VAPB in various expression systems, researchers can analyze its biochemical properties, functional roles, and potential as a therapeutic target. This ongoing research not only enhances the understanding of the molecular mechanisms underlying neurodegenerative diseases but also opens avenues for developing strategies to restore normal function in affected neurons. As such, VAPB remains a focal point of study in neurology and cell biology, highlighting the intricate connections between protein function and disease pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US