Analytical Data
-
Gene name
IMPAD1
- Application
-
Alternative Names
BPNT2;IMPA3;IMPAD1;Golgi-resident adenosine 3'.5'-bisphosphate 3'-phosphatase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NX62
-
Expression Region
34-359aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSGRFSLFGLGGEPGGGAAGPAAAADGGT VDLREMLAVSVLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGD VLSNRKMFYLLKTAFPSVQINTEEHVDAADQEVILWDHKIPEDILKEVTT PKEVPAESVTVWIDPLDATQEYTEDLRKYVTTMVCVAVNGKPMLGVIHKP FSEYTAWAMVDGGSNVKARSSYNEKTPRIVVSRSHSGMVKQVALQTFGNQ TTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIKKWDICAGNAILKA LGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTGHK
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IMPAD1 (Inositol Monophosphatase Domain Containing 1) is a recently identified protein that has garnered significant attention in the field of molecular biology and biochemistry due to its potential roles in various biological processes. This protein is characterized by its inositol monophosphatase activity, which is crucial for inositol signaling pathways, impacting cellular functions such as cell proliferation, neurotransmitter release, and metabolism. Recent studies have shown that dysregulation of inositol metabolism is associated with several diseases, including mood disorders, cancer, and neurodegenerative diseases, prompting researchers to explore the therapeutic potential of targeting IMPAD1. Investigations into its structural features, enzymatic activity, and interaction with other cellular components are ongoing, as these insights may unveil novel signaling mechanisms and therapeutic avenues. The functional characterization of IMPAD1 is particularly important for understanding its role in the central nervous system and its implications in psychiatric conditions, where inositol signaling is often disrupted. Furthermore, the development of specific inhibitors or modulators of IMPAD1 may provide new strategies for disease intervention, making it a focal point for future research in drug discovery and molecular therapeutics. Overall, the study of IMPAD1 is poised to enhance our understanding of inositol signaling and its broader implications in human health and disease.
