Analytical Data
-
Gene name
IL7
- Application
-
Alternative Names
IL7;Interleukin-7
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13232
-
Expression Region
26-177aa
-
AA Sequence
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-7 (IL-7) is a crucial cytokine involved in the regulation of immune responses, particularly in the development and homeostasis of T and B lymphocytes. Its importance in immunology has garnered significant attention, as it plays a vital role in lymphocyte survival, proliferation, and differentiation. Research into recombinant IL-7 protein has intensified due to its potential therapeutic applications, particularly in enhancing immune recovery in immunocompromised patients, such as those undergoing cancer treatment or individuals with HIV/AIDS. Recombinant IL-7 has been studied for its ability to restore T cell populations, improve immune function, and ultimately enhance the efficacy of vaccines and immunotherapies. Additionally, its role in promoting the development of lymphoid tissues has implications for understanding immune system maturation and function in health and disease. Given the rising urgency of addressing immunodeficient conditions, the exploration of recombinant IL-7 as a treatment modality signifies a promising frontier in immunotherapeutics and regenerative medicine, potentially leading to improved clinical outcomes in various patient populations.
