Analytical Data
-
Gene name
KCNE1
- Application
-
Alternative Names
KCNE1; Potassium voltage-gated channel subfamily E member 1; Delayed rectifier potassium channel subunit IsK; IKs producing slow voltage-gated potassium channel subunit beta Mink; Minimal potassium channel
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P15382
-
Expression Region
1-105aa
-
AA Sequence
MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
-
Molecular Weight
37.29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNE1, a member of the potassium channel accessory protein family, plays a crucial role in modulating the function of voltage-gated potassium channels, particularly the KCNQ1 channel, which is essential for cardiac repolarization. Mutations in the KCNE1 gene have been linked to various cardiovascular conditions, including Long QT Syndrome, a disorder that can lead to life-threatening arrhythmias. Given the importance of KCNE1 in cardiac physiology, researchers have increasingly focused on the expression and characterization of recombinant KCNE1 proteins. The study of these proteins provides insights into their interactions with other ion channels, their regulatory mechanisms, and their physiological roles in the heart. Purified KCNE1 proteins, produced through recombinant DNA technology, allow for advanced biochemical and electrophysiological studies, facilitating the understanding of how KCNE1 modulates ion channel activity and its contribution to human health and disease. This research is pivotal for the development of targeted therapies for heart conditions associated with ion channel dysfunction.
